Recombinant Bacteriophage K3 T protein, His&Myc-tagged
Cat.No. : | T-754B |
Product Overview : | Recombinant Bacteriophage K3 T protein(P10393)(50-218aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacteriophage K3 |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 50-218a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RGDSFFEYYKQSKYETYSEIIEKERNARFESVALEQLQIVHISSEADFSAVYSFRPKNLNYFVDIIAYEGKLPSTISEKSLGGYPVDKTMDEYTVHLNGRHYYSNSKFAFLPTKKPTPEINYMYSCPYFNLDNIYAGTITMYWYRNDHISNDRLESICSQAARILGRAK |
◆ Recombinant Proteins | ||
T-6500C | Recombinant Chicken T | +Inquiry |
T-6267M | Recombinant Mouse T Protein, Myc/DDK-tagged | +Inquiry |
T-27672TH | Recombinant Human T | +Inquiry |
T-16350M | Recombinant Mouse T Protein | +Inquiry |
T-27668TH | Recombinant Human T | +Inquiry |
◆ Cell & Tissue Lysates | ||
T-1294HCL | Recombinant Human T 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All T Products
Required fields are marked with *
My Review for All T Products
Required fields are marked with *
0
Inquiry Basket