Recombinant Bacteriophage MS2 CP protein, His&Myc-tagged
Cat.No. : | CP-4270B |
Product Overview : | Recombinant Bacteriophage MS2 CP protein(P03612)(2-130aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacteriophage MS2 |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-130aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.2 kDa |
AA Sequence : | ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
CP-01C | Recombinant Chlamydia pneumonia antigen, His-tagged | +Inquiry |
Cp-832M | Recombinant Mouse Cp Protein, His&GST-tagged | +Inquiry |
CP-5625H | Recombinant Human CP protein, His-tagged | +Inquiry |
CP-932H | Recombinant Human CP protein(807-1050aa), His-tagged | +Inquiry |
Cp-5626M | Recombinant Mouse Cp protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
CP-8074M | Native Mouse Serum Ceruloplasmin | +Inquiry |
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
CP-8073H | Native Human Plasma Ceruloplasmin | +Inquiry |
CP-26450TH | Native Human CP | +Inquiry |
CP-5326H | Native Human Ceruloplasmin (ferroxidase) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CP Products
Required fields are marked with *
My Review for All CP Products
Required fields are marked with *
0
Inquiry Basket