Recombinant Betula Pendula Bet VI protein, His-tagged
| Cat.No. : | BETVI-01H |
| Product Overview : | Recombinant Betula Pendula Bet VI protein with N-terminal His6 fusion tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Betula Pendula |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 167 |
| Description : | May be a general steroid carrier protein |
| Form : | Buffered aqueous solution |
| Molecular Mass : | 18.45 kDa |
| AA Sequence : | MGHHHHHHGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEM GETLLRAVESYLLAHSDAYN |
| Purity : | >90% by SDS-PAGE |
| Applications : | ELISA |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/ml |
| Storage Buffer : | Solution in PBS, pH7.4 |
| Gene Name | BETVI |
| Official Symbol | BETVI |
| Synonyms | BETVIA |
| Gene ID | X15877.1 |
| mRNA Refseq | MW202012.1 |
| Protein Refseq | P15494.2 |
| UniProt ID | P15494 |
| ◆ Recombinant Proteins | ||
| BETVI-01H | Recombinant Betula Pendula Bet VI protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BETVI Products
Required fields are marked with *
My Review for All BETVI Products
Required fields are marked with *
Recently Viewed
