Recombinant Betula Pendula Bet VII protein, His-tagged

Cat.No. : BETVII-01H
Product Overview : Recombinant Betula Pendula Bet VII protein with C-terminal His6 fusion tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Betula Pendula
Source : E.coli
Tag : His
Protein Length : 141
Description : Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.
Form : Buffered aqueous solution
Molecular Mass : 15.3 kDa
AA Sequence : MGMSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGLHHHHHH
Purity : >90% by SDS-PAGE
Applications : ELISA
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.51 mg/ml
Storage Buffer : Solution in 50mM Tris, 0.3 M NaCl, 1M Urea, pH8.0
Gene Name BETVII
Official Symbol BETVII
Synonyms Allergen Bet v II, Pollen allergen Bet v 2
Gene ID M65179.1
mRNA Refseq M65179.1
Protein Refseq P25816.1
UniProt ID P25816

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BETVII Products

Required fields are marked with *

My Review for All BETVII Products

Required fields are marked with *

0
cart-icon