Recombinant Betula Pendula Bet VII protein, His-tagged
| Cat.No. : | BETVII-01H |
| Product Overview : | Recombinant Betula Pendula Bet VII protein with C-terminal His6 fusion tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Betula Pendula |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 141 |
| Description : | Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. |
| Form : | Buffered aqueous solution |
| Molecular Mass : | 15.3 kDa |
| AA Sequence : | MGMSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGLHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Applications : | ELISA |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.51 mg/ml |
| Storage Buffer : | Solution in 50mM Tris, 0.3 M NaCl, 1M Urea, pH8.0 |
| Gene Name | BETVII |
| Official Symbol | BETVII |
| Synonyms | Allergen Bet v II, Pollen allergen Bet v 2 |
| Gene ID | M65179.1 |
| mRNA Refseq | M65179.1 |
| Protein Refseq | P25816.1 |
| UniProt ID | P25816 |
| ◆ Recombinant Proteins | ||
| BETVII-4001B | Recombinant Betula verrucosa BETVII protein, His-SUMO-tagged | +Inquiry |
| BETVII-567B | Recombinant Betula pendula BETVIA protein | +Inquiry |
| BETVII-1641B | Recombinant Betula pendula BETVII Protein (Met1-Leu133), N-His tagged | +Inquiry |
| BETVII-01H | Recombinant Betula Pendula Bet VII protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BETVII Products
Required fields are marked with *
My Review for All BETVII Products
Required fields are marked with *
