Recombinant Betula Pendula Bet VII protein, His-tagged
Cat.No. : | BETVII-01H |
Product Overview : | Recombinant Betula Pendula Bet VII protein with C-terminal His6 fusion tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Betula Pendula |
Source : | E.coli |
Tag : | His |
Protein Length : | 141 |
Description : | Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. |
Form : | Buffered aqueous solution |
Molecular Mass : | 15.3 kDa |
AA Sequence : | MGMSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGLHHHHHH |
Purity : | >90% by SDS-PAGE |
Applications : | ELISA |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.51 mg/ml |
Storage Buffer : | Solution in 50mM Tris, 0.3 M NaCl, 1M Urea, pH8.0 |
Gene Name | BETVII |
Official Symbol | BETVII |
Synonyms | Allergen Bet v II, Pollen allergen Bet v 2 |
Gene ID | M65179.1 |
mRNA Refseq | M65179.1 |
Protein Refseq | P25816.1 |
UniProt ID | P25816 |
◆ Recombinant Proteins | ||
BETVII-01H | Recombinant Betula Pendula Bet VII protein, His-tagged | +Inquiry |
BETVII-1641B | Recombinant Betula pendula BETVII Protein (Met1-Leu133), N-His tagged | +Inquiry |
BETVII-4001B | Recombinant Betula verrucosa BETVII protein, His-SUMO-tagged | +Inquiry |
BETVII-567B | Recombinant Betula pendula BETVIA protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BETVII Products
Required fields are marked with *
My Review for All BETVII Products
Required fields are marked with *
0
Inquiry Basket