Recombinant Betula verrucosa BETVIA protein, His-SUMO-tagged
Cat.No. : | BETVIA-3891B |
Product Overview : | Recombinant Betula verrucosa BETVIA protein(P15494)(2-160aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Betula verrucosa |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-160aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.4 kDa |
AA Sequence : | GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
BETVIA-3891B | Recombinant Betula verrucosa BETVIA protein, His-SUMO-tagged | +Inquiry |
BETVIA-566B | Recombinant Betula pendula BETVIA protein | +Inquiry |
BETVIA-2719S | Recombinant Spinach BETVIA Protein, His-tagged | +Inquiry |
BETVIA-1640B | Recombinant Betula pendula BETVIA Protein (Met1-Asn160), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BETVIA Products
Required fields are marked with *
My Review for All BETVIA Products
Required fields are marked with *