Recombinant Bordetella Pertussis FIM3 Protein (26-204 aa), His-SUMO-tagged
Cat.No. : | FIM3-888B |
Product Overview : | Recombinant Bordetella Pertussis (strain Tohama I/ATCC BAA-589/NCTC 13251) FIM3 Protein (26-204 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella Pertussis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 26-204 aa |
Description : | Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 35.2 kDa |
AA Sequence : | NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | P17835 |
◆ Recombinant Proteins | ||
fim3-3900B | Recombinant Bordetella pertussis fim3 protein, His-tagged | +Inquiry |
FIM3-888B | Recombinant Bordetella Pertussis FIM3 Protein (26-204 aa), His-SUMO-tagged | +Inquiry |
FIM3-2462B | Recombinant Bordetella Pertussis FIM3 Protein (26-204 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FIM3 Products
Required fields are marked with *
My Review for All FIM3 Products
Required fields are marked with *
0
Inquiry Basket