Recombinant Bordetella Pertussis PTXA Protein (35-269 aa), His-tagged
Cat.No. : | PTXA-1609B |
Product Overview : | Recombinant Bordetella Pertussis (strain Tohama I/ATCC BAA-589/NCTC 13251) PTXA Protein (35-269 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella Pertussis |
Source : | Yeast |
Tag : | His |
Protein Length : | 35-269 aa |
Description : | S1 is an NAD-dependent ADP-ribosyltransferase, which plays a crucial role in the pathogenesis of B.pertussis causing disruption of normal host cellular regulation. It catalyzes the ADP-ribosylation of a cysteine in the alpha subunit of host heterotrimeric G proteins. In the absence of G proteins it also catalyzes the cleavage of NAD+ into ADP-ribose and nicotinamide. It irreversibly uncouples the G-alpha GTP-binding proteins from their mbrane receptors. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.2 kDa |
AA Sequence : | DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | ptxA pertussis toxin subunit 1 [ Bordetella pertussis Tohama I ] |
Official Symbol | PTXA |
Synonyms | ptxA; Islet-activating protein S1; IAP S1NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-); |
Gene ID | 2665068 |
Protein Refseq | NP_882282 |
UniProt ID | P04977 |
◆ Recombinant Proteins | ||
PTXA-938B | Recombinant Bordetella Pertussis PTXA Protein (35-269 aa), His-tagged | +Inquiry |
PTXA-1609B | Recombinant Bordetella Pertussis PTXA Protein (35-269 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTXA Products
Required fields are marked with *
My Review for All PTXA Products
Required fields are marked with *
0
Inquiry Basket