Recombinant Bos PRNP Protein, His-Tagged

Cat.No. : Prnp-01B
Product Overview : Recombinant Bos PRNP Protein, His-Tagged was expressed in E.coli BL21 cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bos
Source : E.coli
Tag : His
Description : The function of PrP is still under debate. May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May play a role in iron uptake and iron homeostasis (By similarity). Isoform 2 may act as a growth suppressor by arresting the cell cycle at the G0/G1 phase. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro).
Form : Liquid
Molecular Mass : 25 kDa including tags
AA Sequence : MKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHGQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGSDYEDRYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGASHHHHHH
Purity : > 95 % SDS-PAGE.
Expressed in E.coli BL21, solubilized from inclusion bodies in 6 M guanidine-HCl, and purified by Ni(II)-nitriloacetate agarose chromatography, followed by reversed-phase HPLC (C4 column). The rPrPc appears as a single protein band of about 27 kDa in SDS-PAGE (>95% of total protein).
Applications : SDS-PAGE, ELISA
Storage : Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 4.00
Constituent: 0.082% Sodium acetate
Concentration : 100 µg at 2 mg/ml
Shipping : Shipped at 4°C.
Gene Name PRNP prion protein [ Bos taurus (cattle) ]
Official Symbol PRNP
Synonyms AltPrP, ASCR, CD230, CD230 antigen, CJD, GSS, KURU, Major prion protein, p27 30, PRIO_HUMAN, Prion protein, Prion related protein, PRIP, PRNP, PrP, PrP27 30, PrP27-30, PrP33-35C, PrPC, PrPSc, Sinc
Gene ID 281427
mRNA Refseq NM_001271625.3
Protein Refseq NP_001258554.1
UniProt ID F7VJQ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRNP Products

Required fields are marked with *

My Review for All PRNP Products

Required fields are marked with *

0
cart-icon
0
compare icon