Recombinant Bos PRNP Protein, His-Tagged
Cat.No. : | Prnp-01B |
Product Overview : | Recombinant Bos PRNP Protein, His-Tagged was expressed in E.coli BL21 cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bos |
Source : | E.coli |
Tag : | His |
Description : | The function of PrP is still under debate. May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May play a role in iron uptake and iron homeostasis (By similarity). Isoform 2 may act as a growth suppressor by arresting the cell cycle at the G0/G1 phase. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro). |
Form : | Liquid |
Molecular Mass : | 25 kDa including tags |
AA Sequence : | MKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHGQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGSDYEDRYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGASHHHHHH |
Purity : | > 95 % SDS-PAGE. Expressed in E.coli BL21, solubilized from inclusion bodies in 6 M guanidine-HCl, and purified by Ni(II)-nitriloacetate agarose chromatography, followed by reversed-phase HPLC (C4 column). The rPrPc appears as a single protein band of about 27 kDa in SDS-PAGE (>95% of total protein). |
Applications : | SDS-PAGE, ELISA |
Storage : | Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. pH: 4.00 Constituent: 0.082% Sodium acetate |
Concentration : | 100 µg at 2 mg/ml |
Shipping : | Shipped at 4°C. |
Gene Name | PRNP prion protein [ Bos taurus (cattle) ] |
Official Symbol | PRNP |
Synonyms | AltPrP, ASCR, CD230, CD230 antigen, CJD, GSS, KURU, Major prion protein, p27 30, PRIO_HUMAN, Prion protein, Prion related protein, PRIP, PRNP, PrP, PrP27 30, PrP27-30, PrP33-35C, PrPC, PrPSc, Sinc |
Gene ID | 281427 |
mRNA Refseq | NM_001271625.3 |
Protein Refseq | NP_001258554.1 |
UniProt ID | F7VJQ2 |
◆ Recombinant Proteins | ||
PRNP-6005H | Recombinant Human PRNP Protein (Gln91-Ser231) | +Inquiry |
PRNP-555C | Recombinant Cynomolgus Monkey PRNP Protein, His (Fc)-Avi-tagged | +Inquiry |
PRNP-789H | Recombinant Human Prion Protein, His-tagged | +Inquiry |
Prnp-799B | Recombinant Bovine Prion Protein, His-tagged | +Inquiry |
Prnp-5501R | Recombinant Rat Prnp protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRNP Products
Required fields are marked with *
My Review for All PRNP Products
Required fields are marked with *