Recombinant Bovine APOA1 protein, His-B2M-tagged
| Cat.No. : | APOA1-2529B |
| Product Overview : | Recombinant Bovine APOA1 protein(P15497)(25-265aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 25-265aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.5 |
| AA Sequence : | DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| Apoa1-631M | Recombinant Mouse Apoa1 Protein, MYC/DDK-tagged | +Inquiry |
| APOA1-2725P | Recombinant Pig APOA1 protein, His & GST-tagged | +Inquiry |
| APOA1-4228H | Active Recombinant Human APOA1 protein, His-tagged | +Inquiry |
| APOA1-205P | Recombinant Pig APOA1 Protein, His-tagged | +Inquiry |
| APOA1-1331B | Recombinant Bovine APOA1 Protein (25-265 aa), His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
| APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
| APOA1-8344H | Native Human APOA1 | +Inquiry |
| APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
| APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
| APOA1-1497MCL | Recombinant Mouse APOA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOA1 Products
Required fields are marked with *
My Review for All APOA1 Products
Required fields are marked with *



