Recombinant Bovine APOA1 Protein (25-265 aa), His-tagged

Cat.No. : APOA1-1331B
Product Overview : Recombinant Bovine APOA1 Protein (25-265 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : Yeast
Tag : His
Protein Length : 25-265 aa
Description : Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 29.5 kDa
AA Sequence : DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name APOA1 apolipoprotein A1 [ Bos taurus (cattle) ]
Official Symbol APOA1
Synonyms APOA1; Apolipoprotein A1;
Gene ID 281631
mRNA Refseq NM_174242
Protein Refseq NP_776667
UniProt ID P15497

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOA1 Products

Required fields are marked with *

My Review for All APOA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon