Recombinant Bovine APOA1 Protein (25-265 aa), His-tagged
Cat.No. : | APOA1-1331B |
Product Overview : | Recombinant Bovine APOA1 Protein (25-265 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | His |
Protein Length : | 25-265 aa |
Description : | Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 29.5 kDa |
AA Sequence : | DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | APOA1 apolipoprotein A1 [ Bos taurus (cattle) ] |
Official Symbol | APOA1 |
Synonyms | APOA1; Apolipoprotein A1; |
Gene ID | 281631 |
mRNA Refseq | NM_174242 |
Protein Refseq | NP_776667 |
UniProt ID | P15497 |
◆ Recombinant Proteins | ||
APOA1-2594H | Recombinant Human APOA1 protein | +Inquiry |
Apoa1-7166M | Recombinant Mouse Apoa1 Protein, His-tagged | +Inquiry |
APOA1-33H | Recombinant Human APOA1 protein(Met1-Gln267), hFc-tagged | +Inquiry |
APOA1-689H | Recombinant Human APOA1 protein, GST-tagged | +Inquiry |
ApoA1-8446R | Active Recombinant Rat ApoA1 | +Inquiry |
◆ Native Proteins | ||
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
APOA1-8344H | Native Human APOA1 | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
APOA1-256H | Native Human APOA1 protein | +Inquiry |
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA1-1497MCL | Recombinant Mouse APOA1 cell lysate | +Inquiry |
APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOA1 Products
Required fields are marked with *
My Review for All APOA1 Products
Required fields are marked with *