Recombinant Bovine APOA1 Protein (25-265 aa), His-tagged
| Cat.No. : | APOA1-1331B |
| Product Overview : | Recombinant Bovine APOA1 Protein (25-265 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 25-265 aa |
| Description : | Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 29.5 kDa |
| AA Sequence : | DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | APOA1 apolipoprotein A1 [ Bos taurus (cattle) ] |
| Official Symbol | APOA1 |
| Synonyms | APOA1; Apolipoprotein A1; |
| Gene ID | 281631 |
| mRNA Refseq | NM_174242 |
| Protein Refseq | NP_776667 |
| UniProt ID | P15497 |
| ◆ Recombinant Proteins | ||
| APOA1-699H | Recombinant Human APOA1 protein | +Inquiry |
| Apoa1-545M | Recombinant Mouse Apoa1 protein, His&Myc-tagged | +Inquiry |
| APOA1-2529B | Recombinant Bovine APOA1 protein, His-B2M-tagged | +Inquiry |
| APOA1-2725P | Recombinant Pig APOA1 protein, His & GST-tagged | +Inquiry |
| APOA1-1111HF | Recombinant Full Length Human APOA1 Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
| APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
| APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
| APOA1-256H | Native Human APOA1 protein | +Inquiry |
| APOA1-8344H | Native Human APOA1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
| APOA1-1497MCL | Recombinant Mouse APOA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOA1 Products
Required fields are marked with *
My Review for All APOA1 Products
Required fields are marked with *
