Recombinant Bovine CCL20 Protein (27-96 aa), His-SUMO-tagged

Cat.No. : CCL20-1082B
Product Overview : Recombinant Bovine CCL20 Protein (27-96 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : E.coli
Tag : His&SUMO
Protein Length : 27-96 aa
Description : Chotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 24.1 kDa
AA Sequence : ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name CCL20 C-C motif chemokine ligand 20 [ Bos taurus (cattle) ]
Official Symbol CCL20
Gene ID 281666
mRNA Refseq NM_174263
Protein Refseq NP_776688
UniProt ID Q8SQB1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL20 Products

Required fields are marked with *

My Review for All CCL20 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon