Recombinant Bovine CSF2 protein, His-Myc-tagged
Cat.No. : | CSF2-038B |
Product Overview : | Recombinant Bovine CSF2 protein(18-143aa)(P11052), fused to C-terminal His tag and Myc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 18-143aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18 kDa |
AA Sequence : | APTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCWEPAQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
CSF2-383H | Recombinant Human Colony Stimulating Factor 2 (granulocyte-macrophage), His-tagged | +Inquiry |
Csf2-012C | Active Recombinant Rat Csf2 Protein (128 aa) | +Inquiry |
CSF2-50P | Recombinant Active Pig CSF2 Protein, His-tagged(N-ter) | +Inquiry |
Csf2-609M | Active Recombinant Mouse Csf2 Protein | +Inquiry |
CSF2-276C | Active Recombinant Human CSF2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF2 Products
Required fields are marked with *
My Review for All CSF2 Products
Required fields are marked with *