Recombinant Human FN1 protein, GST-tagged
| Cat.No. : | FN1-1811H |
| Product Overview : | Recombinant Human FN1 protein(2177-2386 aa), fused to GST tag, was expressed in E. coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 2177-2386 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FN1 fibronectin 1 [ Homo sapiens ] |
| Official Symbol | FN1 |
| Synonyms | FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149; |
| Gene ID | 2335 |
| mRNA Refseq | NM_002026 |
| Protein Refseq | NP_002017 |
| MIM | 135600 |
| UniProt ID | P02751 |
| ◆ Recombinant Proteins | ||
| FN1-420H | Recombinant Human FN1 Protein | +Inquiry |
| FN1-4400H | Recombinant Human FN1 Protein, GST-tagged | +Inquiry |
| FN1-01H | Recombinant Human FN1 Protein, T7-His-TEV-tagged | +Inquiry |
| FN1-107H | Recombinant Human Fibronectin III 8-10, 13, GST-tagged | +Inquiry |
| FN1-1374H | Recombinant Human FN1 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| Fn1-5424M | Native Mouse Fibronectin | +Inquiry |
| FN1-701H | Native Human Fibronectin 1 | +Inquiry |
| FN1-2708H | Native Human FN1 protein | +Inquiry |
| FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
| Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FN1-2956HCL | Recombinant Human FN1 cell lysate | +Inquiry |
| FN1-166HKCL | Human FN1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FN1 Products
Required fields are marked with *
My Review for All FN1 Products
Required fields are marked with *



