Recombinant Bovine GNAT2 protein, His-tagged
Cat.No. : | GNAT2-2976B |
Product Overview : | Recombinant Bovine GNAT2 protein(P04696)(2-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-354aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44 kDa |
AA Sequence : | GSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEYKAIIYGNVLQSILAIIRAMPTLGIDYAEVSCVDNGRQLNNLADSIEEGTMPPELVEVIRKLWKDGGVQACFDRAAEYQLNDSASYYLNQLDRITAPDYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
GNAT2-3046H | Recombinant Human GNAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNAT2-5049H | Recombinant Human GNAT2 Protein, GST-tagged | +Inquiry |
GNAT2-5337HF | Recombinant Full Length Human GNAT2 Protein, GST-tagged | +Inquiry |
GNAT2-225H | Recombinant Human GNAT2 | +Inquiry |
GNAT2-2424B | Recombinant Bovine GNAT2 Protein (2-354 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNAT2-5865HCL | Recombinant Human GNAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNAT2 Products
Required fields are marked with *
My Review for All GNAT2 Products
Required fields are marked with *
0
Inquiry Basket