Recombinant Bovine GNAT2 protein, His-tagged
| Cat.No. : | GNAT2-2976B |
| Product Overview : | Recombinant Bovine GNAT2 protein(P04696)(2-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-354aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44 kDa |
| AA Sequence : | GSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEYKAIIYGNVLQSILAIIRAMPTLGIDYAEVSCVDNGRQLNNLADSIEEGTMPPELVEVIRKLWKDGGVQACFDRAAEYQLNDSASYYLNQLDRITAPDYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| GNAT2-3046H | Recombinant Human GNAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Gnat2-1029M | Recombinant Mouse Gnat2 Protein, MYC/DDK-tagged | +Inquiry |
| GNAT2-5049H | Recombinant Human GNAT2 Protein, GST-tagged | +Inquiry |
| GNAT2-9373Z | Recombinant Zebrafish GNAT2 | +Inquiry |
| GNAT2-6256C | Recombinant Chicken GNAT2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNAT2-5865HCL | Recombinant Human GNAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNAT2 Products
Required fields are marked with *
My Review for All GNAT2 Products
Required fields are marked with *



