Recombinant Human GNAT2 Protein, GST-tagged

Cat.No. : GNAT2-5049H
Product Overview : Human GNAT2 full-length ORF ( NP_005263.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in cones. [provided by RefSeq
Molecular Mass : 66.6 kDa
AA Sequence : MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNAT2 guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 [ Homo sapiens ]
Official Symbol GNAT2
Synonyms GNAT2; guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2; guanine nucleotide-binding protein G(t) subunit alpha-2; ACHM4; transducin alpha-2 chain; cone-type transducin alpha subunit; transducin, cone-specific, alpha polypeptide; GNATC;
Gene ID 2780
mRNA Refseq NM_005272
Protein Refseq NP_005263
MIM 139340
UniProt ID P19087

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNAT2 Products

Required fields are marked with *

My Review for All GNAT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon