Recombinant Bovine IGF2 protein, hFc-tagged
Cat.No. : | IGF2-7544B |
Product Overview : | Recombinant Bovine IGF2 protein(P07456)(25-91aa), fused with N-terminal hFc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | Fc |
Protein Length : | 25-91aa |
Tag : | N-hFc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE |
◆ Recombinant Proteins | ||
IGF2-819R | Recombinant Rabbit IGF2 protein, His & T7-tagged | +Inquiry |
Igf2-818R | Recombinant Rat Igf2 protein, His-tagged | +Inquiry |
IGF2-371H | Active Recombinant Human IGF2 insulin-like growth factor 2 (somatomedin A) | +Inquiry |
IGF2-570H | Recombinant Human IGF2, His & NusA tagged | +Inquiry |
IGF2-01H | Recombinant Human IGF2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
IGF2-29116TH | Native Human IGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF2-5266HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
IGF2-5267HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF2 Products
Required fields are marked with *
My Review for All IGF2 Products
Required fields are marked with *