Recombinant Bovine INS protein, His-KSI-tagged
Cat.No. : | INS-674B |
Product Overview : | Recombinant Bovine INS protein(P01317)(25-54aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 25-54a.a. |
Tag : | His-KSI |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
◆ Recombinant Proteins | ||
INS-29H | Recombinant Human INS protein | +Inquiry |
INS-64P | Recombinant Pongo pygmaeus INS1 Protein | +Inquiry |
INS-674B | Recombinant Bovine INS protein, His-KSI-tagged | +Inquiry |
INS-856H | Recombinant Human INS Protein, His-tagged | +Inquiry |
INS-341H | Recombinant Human INS | +Inquiry |
◆ Native Proteins | ||
INS-5435B | Native Bovine Insulin | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
◆ Cell & Tissue Lysates | ||
INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *
0
Inquiry Basket