Recombinant Bovine ITIH2 protein, His-KSI-tagged
Cat.No. : | ITIH2-4336B |
Product Overview : | Recombinant Bovine ITIH2 protein(P56651)(1-50aa), fused to N-terminal His tag and KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 1-50aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.3 kDa |
AA Sequence : | LHYQEVKWRKLGSYEHRLHLKPGRLAKHELEVFNGYFVHFPAPENMIPIG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
ITIH2-3859C | Recombinant Chicken ITIH2 | +Inquiry |
Itih2-975M | Recombinant Mouse Itih2 protein, His&Myc-tagged | +Inquiry |
ITIH2-4336B | Recombinant Bovine ITIH2 protein, His-KSI-tagged | +Inquiry |
ITIH2-1569H | Recombinant Human ITIH2 protein, His & T7-tagged | +Inquiry |
ITIH2-12249Z | Recombinant Zebrafish ITIH2 | +Inquiry |
◆ Native Proteins | ||
Itih2-01M | Recombinant Mouse Itih2 protein, His tagged | +Inquiry |
Itih2-979M | Recombinant Mouse Itih2 mutant protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITIH2-5119HCL | Recombinant Human ITIH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITIH2 Products
Required fields are marked with *
My Review for All ITIH2 Products
Required fields are marked with *
0
Inquiry Basket