Recombinant Bovine MMP9 protein(107-712aa), His-tagged
| Cat.No. : | MMP9-21B | 
| Product Overview : | Recombinant Bovine MMP9 protein(P52176)(107-712aa), fused with C-terminal His tag, was expressed in Yeast. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine | 
| Source : | Yeast | 
| Tag : | His | 
| Protein Length : | 107-712aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 68.8 kDa | 
| AA Sequence : | FQTFEGELKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYGPEADIVIQFGVREHGDGYPFDGKNGLLAHAFPPGKGIQGDAHFDDEELWSLGKGVVIPTYFGNAKGAACHFPFTFEGRSYSACTTDGRSDDMLWCSTTADYDADRQFGFCPSERLYTQDGNADGKPCVFPFTFQGRTYSACTSDGRSDGYRWCATTANYDQDKLYGFCPTRVDATVTGGNAAGELCVFPFTFLGKEYSACTREGRNDGHLWCATTSNFDKDKKWGFCPDQGYSLFLVAAHEFGHALGLDHTSVPEALMYPMYRFTEEHPLHRDDVQGIQHLYGPRPEPEPRPPTTTTTTTTEPQPTAPPTVCVTGPPTARPSEGPTTGPTGPPAAGPTGPPTAGPSAAPTESPDPAEDVCNVDIFDAIAEIRNRLHFFKAGKYWRLSEGGGRRVQGPFLVKSKWPALPRKLDSAFEDPLTKKIFFFSGRQVWVYTGASLLGPRRLDKLGLGPEVAQVTGALPRPEGKVLLFSGQSFWRFDVKTQKVDPQSVTPVDQMFPGVPISTHDIFQYQEKAYFCQDHFYWRVSSQNEVNQVDYVGYVTFDLLKCPED | 
| Purity : | Greater than 95% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | MMP9 matrix metallopeptidase 9 [ Bos taurus (cattle) ] | 
| Official Symbol | MMP9 | 
| Synonyms | MMP-9;92 kDa gelatinase;92 kDa type IV collagenase;Gelatinase B;GELB | 
| Gene ID | 282871 | 
| mRNA Refseq | NM_174744 | 
| Protein Refseq | NP_777169 | 
| UniProt ID | P52176 | 
| ◆ Recombinant Proteins | ||
| Mmp9-1788M | Recombinant Mouse Mmp9 Protein, His&GST-tagged | +Inquiry | 
| Mmp9-436R | Recombinant Rat Mmp9 protein, His-tagged | +Inquiry | 
| MMP9-1128D | Recombinant Dog MMP9 Protein, His-tagged | +Inquiry | 
| MMP9-118H | Recombinant Human matrix metallopeptidase 9 Protein, His&Flag tagged | +Inquiry | 
| MMP9-812H | Active Recombinant Human MMP9 protein, His-tagged | +Inquiry | 
| ◆ Native Proteins | ||
| MMP9-30035TH | Native Human MMP9 | +Inquiry | 
| MMP9-01HFL | Active Recombinant Full Length Human MMP9 Protein | +Inquiry | 
| MMP9-38H | Native Human MMP-9 | +Inquiry | 
| MMP9-29698TH | Native Human MMP9 | +Inquiry | 
| MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MMP9-1940RCL | Recombinant Rat MMP9 cell lysate | +Inquiry | 
| MMP9-2560HCL | Recombinant Human MMP9 cell lysate | +Inquiry | 
| MMP9-2026MCL | Recombinant Mouse MMP9 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP9 Products
Required fields are marked with *
My Review for All MMP9 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            