Recombinant Bovine PIGR Protein (400-599 aa), His-tagged
Cat.No. : | PIGR-1483B |
Product Overview : | Recombinant Bovine PIGR Protein (400-599 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | His |
Protein Length : | 400-599 aa |
Description : | This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the Extracellular domain (known as the secretory component) from the transmbrane segment. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.0 kDa |
AA Sequence : | SRGLIKEQYEGRLALLTEPGNGTYTVILNQLTDQDTGFYWCVTDGDTRWISTVELKVVQGEPSLKVPKNVTAWLGEPLKLSCHFPCKFYSFEKYWCKWSNRGCSALPTQNDGPSQAFVSCDQNSQVVSLNLDTVTKEDEGWYWCGVKEGPRYGETAAVYVAVESRVKGSQGAKQVKAAPAGAAIQSRAGEIQNKALLDPS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PIGR polymeric immunoglobulin receptor [ Bos taurus (cattle) ] |
Official Symbol | PIGR |
Synonyms | PIGR; |
Gene ID | 281401 |
mRNA Refseq | NM_174143 |
Protein Refseq | NP_776568 |
UniProt ID | P81265 |
◆ Recombinant Proteins | ||
PIGR-3436C | Recombinant Chicken PIGR | +Inquiry |
PIGR-8496Z | Recombinant Zebrafish PIGR | +Inquiry |
PIGR-1469C | Recombinant Cattle PIGR protein, His-tagged | +Inquiry |
PIGR-830H | Recombinant Human PIGR protein, His-tagged | +Inquiry |
RFL32804OF | Recombinant Full Length Rabbit Polymeric Immunoglobulin Receptor(Pigr) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIGR-2868HCL | Recombinant Human PIGR cell lysate | +Inquiry |
PIGR-2867MCL | Recombinant Mouse PIGR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIGR Products
Required fields are marked with *
My Review for All PIGR Products
Required fields are marked with *