Recombinant Bovine PIGR Protein (400-599 aa), His-tagged

Cat.No. : PIGR-1483B
Product Overview : Recombinant Bovine PIGR Protein (400-599 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : Yeast
Tag : His
Protein Length : 400-599 aa
Description : This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the Extracellular domain (known as the secretory component) from the transmbrane segment.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.0 kDa
AA Sequence : SRGLIKEQYEGRLALLTEPGNGTYTVILNQLTDQDTGFYWCVTDGDTRWISTVELKVVQGEPSLKVPKNVTAWLGEPLKLSCHFPCKFYSFEKYWCKWSNRGCSALPTQNDGPSQAFVSCDQNSQVVSLNLDTVTKEDEGWYWCGVKEGPRYGETAAVYVAVESRVKGSQGAKQVKAAPAGAAIQSRAGEIQNKALLDPS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name PIGR polymeric immunoglobulin receptor [ Bos taurus (cattle) ]
Official Symbol PIGR
Synonyms PIGR;
Gene ID 281401
mRNA Refseq NM_174143
Protein Refseq NP_776568
UniProt ID P81265

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIGR Products

Required fields are marked with *

My Review for All PIGR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon