Recombinant Bovine Prolactin Protein, His-Tagged

Cat.No. : PRL-298B
Product Overview : Recombinant Bovine PRL Protein, His-Tagged was expressed in E.coli cell
Availability October 06, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : E.coli
Tag : His
Protein Length : 31-229 a.a.
Description : Prolactin (PRL), also known as lactotropin, is a protein best known for its role in enabling mammals to produce milk. It is influential in over 300 separate processes in various vertebrates, including humans.[5] Prolactin is secreted from the pituitary gland in response to eating, mating, estrogen treatment, ovulation and nursing. It is secreted heavily in pulses in between these events.
Molecular Mass : The protein has a calculated MW of 24 kDa.
AA Sequence : MGSSHHHHHHTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.19 mg/ml
Storage Buffer : 50mM Tris, 300mM NaCl, pH 8.0
Gene Name PRL prolactin [ Bos taurus (cattle) ]
Official Symbol PRL
Synonyms GHA1; Prol
Gene ID 280901
mRNA Refseq NM_173953.2
Protein Refseq NP_776378.2
UniProt ID P01239

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRL Products

Required fields are marked with *

My Review for All PRL Products

Required fields are marked with *

0
cart-icon
0
compare icon