Recombinant Bovine Prolactin Protein, His-Tagged
| Cat.No. : | PRL-298B |
| Product Overview : | Recombinant Bovine PRL Protein, His-Tagged was expressed in E.coli cell |
| Availability | January 19, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 31-229 a.a. |
| Description : | Prolactin (PRL), also known as lactotropin, is a protein best known for its role in enabling mammals to produce milk. It is influential in over 300 separate processes in various vertebrates, including humans.[5] Prolactin is secreted from the pituitary gland in response to eating, mating, estrogen treatment, ovulation and nursing. It is secreted heavily in pulses in between these events. |
| Molecular Mass : | The protein has a calculated MW of 24 kDa. |
| AA Sequence : | MGSSHHHHHHTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.19 mg/ml |
| Storage Buffer : | 50mM Tris, 300mM NaCl, pH 8.0 |
| Gene Name | PRL prolactin [ Bos taurus (cattle) ] |
| Official Symbol | PRL |
| Synonyms | GHA1; Prol |
| Gene ID | 280901 |
| mRNA Refseq | NM_173953.2 |
| Protein Refseq | NP_776378.2 |
| UniProt ID | P01239 |
| ◆ Recombinant Proteins | ||
| PRL-22O | Active Recombinant Ovine Prolactin / PRL Protein | +Inquiry |
| PRL-2512H | Recombinant Human PRL protein(91-170 aa), C-His-tagged | +Inquiry |
| Prl-7818M | Recombinant Mouse Prl protein, His & GST-tagged | +Inquiry |
| PRL-1192P | Recombinant Pig PRL Protein, His-tagged | +Inquiry |
| PRL-3006H | Recombinant Full Length Human Prolactin Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PRL-8245H | Native Human Prolactin | +Inquiry |
| PRL-111S | Active Native Sheep Prolactin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *
