Recombinant Bovine Prolactin Protein, His-Tagged
Cat.No. : | PRL-298B |
Product Overview : | Recombinant Bovine PRL Protein, His-Tagged was expressed in E.coli cell |
Availability | October 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-229 a.a. |
Description : | Prolactin (PRL), also known as lactotropin, is a protein best known for its role in enabling mammals to produce milk. It is influential in over 300 separate processes in various vertebrates, including humans.[5] Prolactin is secreted from the pituitary gland in response to eating, mating, estrogen treatment, ovulation and nursing. It is secreted heavily in pulses in between these events. |
Molecular Mass : | The protein has a calculated MW of 24 kDa. |
AA Sequence : | MGSSHHHHHHTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.19 mg/ml |
Storage Buffer : | 50mM Tris, 300mM NaCl, pH 8.0 |
Gene Name | PRL prolactin [ Bos taurus (cattle) ] |
Official Symbol | PRL |
Synonyms | GHA1; Prol |
Gene ID | 280901 |
mRNA Refseq | NM_173953.2 |
Protein Refseq | NP_776378.2 |
UniProt ID | P01239 |
◆ Recombinant Proteins | ||
PRL-4497H | Recombinant Horse PRL protein, hFc-tagged | +Inquiry |
Prl-60R | Active Recombinant Rat Prolactin / Prl protein | +Inquiry |
PRL-56H | Active Recombinant Human Prolactin | +Inquiry |
PRL-22O | Active Recombinant Ovine Prolactin / PRL Protein | +Inquiry |
PRL-459H | Recombinant Human PRL protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PRL-8245H | Native Human Prolactin | +Inquiry |
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *