Recombinant Human PRL protein(91-170 aa), C-His-tagged
| Cat.No. : | PRL-2512H |
| Product Overview : | Recombinant Human PRL protein(P01236)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 91-170 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 11 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | LATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETK |
| Gene Name | PRL prolactin [ Homo sapiens ] |
| Official Symbol | PRL |
| Synonyms | PRL; prolactin; decidual prolactin; |
| Gene ID | 5617 |
| mRNA Refseq | NM_000948 |
| Protein Refseq | NP_000939 |
| MIM | 176760 |
| UniProt ID | P01236 |
| ◆ Recombinant Proteins | ||
| PRL-2590H | Recombinant Human PRL Protein (Leu29-Cys227), His tagged | +Inquiry |
| PRL-2178H | Active Recombinant Human PRL protein, His-tagged | +Inquiry |
| Prl-565R | Recombinant Rat Prl protein, His-tagged | +Inquiry |
| PRL-1193S | Recombinant Sheep PRL Protein, His-tagged | +Inquiry |
| Prl-63M | Active Recombinant Mouse Prolactin / Prl Protein | +Inquiry |
| ◆ Native Proteins | ||
| PRL-8245H | Native Human Prolactin | +Inquiry |
| PRL-111S | Active Native Sheep Prolactin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *
