Recombinant Human PRL protein(91-170 aa), C-His-tagged
Cat.No. : | PRL-2512H |
Product Overview : | Recombinant Human PRL protein(P01236)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 91-170 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETK |
Gene Name | PRL prolactin [ Homo sapiens ] |
Official Symbol | PRL |
Synonyms | PRL; prolactin; decidual prolactin; |
Gene ID | 5617 |
mRNA Refseq | NM_000948 |
Protein Refseq | NP_000939 |
MIM | 176760 |
UniProt ID | P01236 |
◆ Recombinant Proteins | ||
PRL-228H | Active Recombinant Human PRL Protein | +Inquiry |
PRL-4497H | Recombinant Horse PRL protein, hFc-tagged | +Inquiry |
Prl-7818M | Recombinant Mouse Prl protein, His & GST-tagged | +Inquiry |
PRL-0044H | Recombinant Human PRL Protein | +Inquiry |
PRL-1194C | Recombinant Cattle PRL Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
PRL-8245H | Native Human Prolactin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *
0
Inquiry Basket