Recombinant Bovine RBP3 Protein (933-1231 aa), GST-tagged
Cat.No. : | RBP3-2329B |
Product Overview : | Recombinant Bovine RBP3 Protein (933-1231 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | GST |
Protein Length : | 933-1231 aa |
Description : | IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 59.5 kDa |
AA Sequence : | AKVPTVLQTAGKLVADNYASPELGVKMAAELSGLQSRYARVTSEAALAELLQADLQVLSGDPHLKTAHIPEDAKDRIPGIVPMQIPSPEVFEDLIKFSFHTNVLEGNVGYLRFDMFGDCELLTQVSELLVEHVWKKIVHTDALIVDMRFNIGGPTSSISALCSYFFDEGPPILLDKIYNRPNNSVSELWTLSQLEGERYGSKKSMVILTSTLTAGAAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTDLYLTIPTARSVGAADGSSWEGVGVVPDVAVPAEAALTRAQEMLQHT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | RBP3 retinol binding protein 3 [ Bos taurus (cattle) ] |
Official Symbol | RBP3 |
Synonyms | RBP3; |
Gene ID | 281443 |
mRNA Refseq | NM_174164 |
Protein Refseq | NP_776589 |
UniProt ID | P12661 |
◆ Recombinant Proteins | ||
RBP3-2181C | Recombinant Chicken RBP3 | +Inquiry |
RBP3-6254H | Recombinant Human RBP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RBP3-35H | Recombinant Human RBP3 Protein, His-tagged | +Inquiry |
RBP3-512H | Recombinant Human RBP3 protein, His-tagged | +Inquiry |
RBP3-6156H | Recombinant Human RBP3 Protein (Pro19-Leu320), His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBP3 Products
Required fields are marked with *
My Review for All RBP3 Products
Required fields are marked with *
0
Inquiry Basket