Recombinant Bovine S100A9 protein, His-B2M & Myc-tagged
| Cat.No. : | S100A9-3465B |
| Product Overview : | Recombinant Bovine S100A9 protein(P28783)(2-156aa), fused to N-terminal His-B2M tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | B2M&His&Myc |
| Protein Length : | 2-156aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34 kDa |
| AA Sequence : | EDKMSQMESSIETIINIFHQYSVRLGHYDTLIQKEFKQLVQKELPNFLKKQKKNEAAINEIMEDLDTNVDKQLSFEEFIMLVARLTVASHEEMHNTAPPGQGHRHGPGYGKGGSGSCSGQGSPDQGSHDLGSHGHGHGHSHGGHGHSHGGHGHSH |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| S100A9-295H | Recombinant Human S100A9, StrepII-tagged | +Inquiry |
| S100A9-301159H | Recombinant Human S100A9 protein, GST-tagged | +Inquiry |
| S100A9-233H | Recombinant Human S100A9 Protein, His-tagged | +Inquiry |
| S100A9-3465B | Recombinant Bovine S100A9 protein, His-B2M & Myc-tagged | +Inquiry |
| S100A9-1214C | Recombinant Cattle S100A9 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A9-684HCL | Recombinant Human S100A9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A9 Products
Required fields are marked with *
My Review for All S100A9 Products
Required fields are marked with *
