Recombinant Bovine SAA1 protein, His-tagged
| Cat.No. : | SAA1-4540B |
| Product Overview : | Recombinant Bovine SAA1 protein(P35541)(19-130aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-130aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.6 kDa |
| AA Sequence : | QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| ◆ Recombinant Proteins | ||
| SAA1-795H | Recombinant Horse SAA1 Protein (1-110 aa), His-tagged | +Inquiry |
| SAA1-2668H | Active Recombinant Human SAA1 protein | +Inquiry |
| SAA1-15F | Recombinant Feline SAA1 Protein (1-111) | +Inquiry |
| SAA1-6232H | Recombinant Full Length Human SAA1 Protein (Met1-Tyr122), C-His tagged | +Inquiry |
| SAA1-14F | Recombinant Feline SAA1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
| SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
