Recombinant Bovine SELENOP protein, GST-tagged
| Cat.No. : | SELENOP-3477B |
| Product Overview : | Recombinant Bovine SELENOP protein(P49907)(20-402aa (U59S,U297S,U307S,U338S,U350S,U363S,U365S,U372S,U388S,U390S,U397S,U399S)), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 20-402aa (U59S,U297S,U307S,U338S,U350S,U363S,U365S,U372S,U388S,U390S,U397S,U399S) |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 70.1 kDa |
| AA Sequence : | ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASSYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLSRKRCINQLLSQFPKDSESALSSCCCHCRHLVFEKTGSAITSQCTEKLPSLCSSQGLLAEENVIESSQSRLPPAASQAAGQQLNPTEASTKSSSKNKAKMSKSPSN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| Selenop-4850M | Recombinant Mouse Selenop protein | +Inquiry |
| Selenop-4853M | Recombinant Mouse Selenop protein | +Inquiry |
| SELENOP-2778H | Recombinant Human SELENOP protein(181-290 aa), C-His-tagged | +Inquiry |
| SELENOP-5469H | Recombinant Human SELENOP Protein (Leu60-Lys274), N-His tagged | +Inquiry |
| Selenop-4849M | Recombinant Mouse Selenop protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SELENOP Products
Required fields are marked with *
My Review for All SELENOP Products
Required fields are marked with *
