Recombinant Bovine SEPP1 Protein (20-402 aa), GST-tagged
Cat.No. : | SEPP1-801B |
Product Overview : | Recombinant Bovine SEPP1 Protein (20-402 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | GST |
Protein Length : | 20-402 aa |
Description : | Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 70.1 kDa |
AA Sequence : | ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASSYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLSRKRCINQLLSQFPKDSESALSSCCCHCRHLVFEKTGSAITSQCTEKLPSLCSSQGLLAEENVIESSQSRLPPAASQAAGQQLNPTEASTKSSSKNKAKMSKSPSN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | P49907 |
◆ Recombinant Proteins | ||
SEPP1-3247C | Recombinant Chicken SEPP1 | +Inquiry |
SEPP1-1513H | Recombinant Human SEPP1 Protein (20-381 aa), His-tagged | +Inquiry |
SEPP1-801B | Recombinant Bovine SEPP1 Protein (20-402 aa), GST-tagged | +Inquiry |
SEPP1-14888M | Recombinant Mouse SEPP1 Protein | +Inquiry |
SEPP1-802H | Recombinant Human SEPP1 Protein (20-381 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEPP1 Products
Required fields are marked with *
My Review for All SEPP1 Products
Required fields are marked with *
0
Inquiry Basket