Recombinant Bovine TNNT1 protein, His&Myc-tagged
Cat.No. : | TNNT1-4333B |
Product Overview : | Recombinant Bovine TNNT1 protein(Q8MKH6)(1-263aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-263aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSDAEEQEYEEEQPEEEEAAEEEEEAPEEPEPAAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDHMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK |
◆ Recombinant Proteins | ||
TNNT1-9626Z | Recombinant Zebrafish TNNT1 | +Inquiry |
TNNT1-13H | Recombinant Human TNNT1 Protein | +Inquiry |
Tnnt1-7949R | Recombinant Rat Tnnt1 protein, His-tagged | +Inquiry |
TNNT1-2228H | Recombinant Human TNNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tnnt1-7948M | Recombinant Mouse Tnnt1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNT1-881HCL | Recombinant Human TNNT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNNT1 Products
Required fields are marked with *
My Review for All TNNT1 Products
Required fields are marked with *
0
Inquiry Basket