Recombinant Human TNNT1 protein, His-tagged

• Cat.No.: TNNT1-7947H
• Product Overview: Recombinant Human TNNT1 protein(Met1~Gly259), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Met1~Gly259
• Tag: N-His
• Form: Liquid in sterile PBS, pH7.4, 0.1% SKL.
• Molecular Mass: The protein has a calculated MW of 32 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.64 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MGHHHHHHSGSEFMSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGG

Gene Information

• Gene Name: TNNT1 troponin T type 1 (skeletal, slow) [ Homo sapiens ]
• Official Symbol: TNNT1
• Synonyms: TNNT1; troponin T type 1 (skeletal, slow); troponin T1, skeletal, slow; troponin T, slow skeletal muscle; ANM; FLJ98147; MGC104241; slow skeletal muscle troponin T; STNT; TNT; TNTS; troponin T1; skeletal; slow; troponin-T1, skeletal, slow
• Gene ID: 7138
• mRNA Refseq: NM_001126132
• Protein Refseq: NP_001119604
• MIM: 191041
• UniProt ID: P13805