Recombinant Human TNNT1 protein, His-tagged
| Cat.No. : | TNNT1-7947H |
| Product Overview : | Recombinant Human TNNT1 protein(Met1~Gly259), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Met1~Gly259 |
| Tag : | N-His |
| Form : | Liquid in sterile PBS, pH7.4, 0.1% SKL. |
| Molecular Mass : | The protein has a calculated MW of 32 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.64 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MGHHHHHHSGSEFMSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGG |
| Gene Name | TNNT1 troponin T type 1 (skeletal, slow) [ Homo sapiens ] |
| Official Symbol | TNNT1 |
| Synonyms | TNNT1; troponin T type 1 (skeletal, slow); troponin T1, skeletal, slow; troponin T, slow skeletal muscle; ANM; FLJ98147; MGC104241; slow skeletal muscle troponin T; STNT; TNT; TNTS; troponin T1; skeletal; slow; troponin-T1, skeletal, slow; |
| Gene ID | 7138 |
| mRNA Refseq | NM_001126132 |
| Protein Refseq | NP_001119604 |
| MIM | 191041 |
| UniProt ID | P13805 |
| ◆ Recombinant Proteins | ||
| TNNT1-2228H | Recombinant Human TNNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TNNT1-9626Z | Recombinant Zebrafish TNNT1 | +Inquiry |
| TNNT1-606H | Recombinant Human TNNT1 Protein, DDK-tagged | +Inquiry |
| TNNT1-3334H | Recombinant Human TNNT1, GST-tagged | +Inquiry |
| TNNT1-5867R | Recombinant Rat TNNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNNT1-881HCL | Recombinant Human TNNT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNNT1 Products
Required fields are marked with *
My Review for All TNNT1 Products
Required fields are marked with *
