Recombinant Human TNNT1 protein, His-tagged

Cat.No. : TNNT1-7947H
Product Overview : Recombinant Human TNNT1 protein(Met1~Gly259), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Met1~Gly259
Tag : N-His
Form : Liquid in sterile PBS, pH7.4, 0.1% SKL.
Molecular Mass : The protein has a calculated MW of 32 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.64 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGHHHHHHSGSEFMSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGG
Gene Name TNNT1 troponin T type 1 (skeletal, slow) [ Homo sapiens ]
Official Symbol TNNT1
Synonyms TNNT1; troponin T type 1 (skeletal, slow); troponin T1, skeletal, slow; troponin T, slow skeletal muscle; ANM; FLJ98147; MGC104241; slow skeletal muscle troponin T; STNT; TNT; TNTS; troponin T1; skeletal; slow; troponin-T1, skeletal, slow;
Gene ID 7138
mRNA Refseq NM_001126132
Protein Refseq NP_001119604
MIM 191041
UniProt ID P13805

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNNT1 Products

Required fields are marked with *

My Review for All TNNT1 Products

Required fields are marked with *

0
cart-icon