Recombinant Bovine VWF protein
| Cat.No. : | VWF-5260B |
| Product Overview : | Recombinant Bovine VWF protein(P80012)(763-937 aa) was expressed in Baculovirus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | Baculovirus |
| Tag : | Non |
| Protein Length : | 763-937 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | SLSCRPPMVKVVCPADNPRAEGLECTKTCQNYDLECMSTGCVSGCLPAPGMVRHENRCVA LERCPCFHQGREYAPGDRVKVDCNSCVCQDRKWNCTDHVCDASCSALGLAHYFTFDGLKY LFPGECQYVLVQDHCGSNPGTFRVLVGNEGCSVPSLKCRKRITILVEGGEIELFD |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| ◆ Recombinant Proteins | ||
| VWF-2714H | Recombinant Human VWF, DDK-tagged | +Inquiry |
| VWF-5259B | Recombinant Bovine VWF protein, Avi-tagged, Biotinylated | +Inquiry |
| Vwf-7789R | Recombinant Rat Vwf protein, His-tagged | +Inquiry |
| VWF-5435HFL | Recombinant Full Length Human VWF, Flag-tagged | +Inquiry |
| VWF-5260B | Recombinant Bovine VWF protein | +Inquiry |
| ◆ Native Proteins | ||
| VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
| VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VWF-001HCL | Recombinant Human VWF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VWF Products
Required fields are marked with *
My Review for All VWF Products
Required fields are marked with *
