Recombinant Bovine VWF protein
Cat.No. : | VWF-5260B |
Product Overview : | Recombinant Bovine VWF protein(P80012)(763-937 aa) was expressed in Baculovirus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Baculovirus |
Tag : | Non |
Protein Length : | 763-937 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | SLSCRPPMVKVVCPADNPRAEGLECTKTCQNYDLECMSTGCVSGCLPAPGMVRHENRCVA LERCPCFHQGREYAPGDRVKVDCNSCVCQDRKWNCTDHVCDASCSALGLAHYFTFDGLKY LFPGECQYVLVQDHCGSNPGTFRVLVGNEGCSVPSLKCRKRITILVEGGEIELFD |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
VWF-10101M | Recombinant Mouse VWF Protein, His (Fc)-Avi-tagged | +Inquiry |
VWF-2643M | Recombinant Mouse VWF Protein (1498-1665 aa), His-Myc-tagged | +Inquiry |
VWF-8353Z | Recombinant Zebrafish VWF | +Inquiry |
VWF-5259B | Recombinant Bovine VWF protein, Avi-tagged, Biotinylated | +Inquiry |
Vwf-7789R | Recombinant Rat Vwf protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
VWF-001HCL | Recombinant Human VWF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VWF Products
Required fields are marked with *
My Review for All VWF Products
Required fields are marked with *