Recombinant Bovine VWF protein

Cat.No. : VWF-5261B
Product Overview : Recombinant Bovine VWF protein(P80012)(763-937 aa) was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : Mammalian cells
Tag : Non
Protein Length : 763-937 aa
Form : Tris/PBS-based buffer, 6% Trehalose.
AASequence : SLSCRPPMVKVVCPADNPRAEGLECTKTCQNYDLECMSTGCVSGCLPAPGMVRHENRCVA LERCPCFHQGREYAPGDRVKVDCNSCVCQDRKWNCTDHVCDASCSALGLAHYFTFDGLKY LFPGECQYVLVQDHCGSNPGTFRVLVGNEGCSVPSLKCRKRITILVEGGEIELFD
Purity : >85% (SDS-PAGE)
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VWF Products

Required fields are marked with *

My Review for All VWF Products

Required fields are marked with *

0
cart-icon