Recombinant C. pasteurianum Rubredoxin Protein, His-SUMO-tagged

• Cat.No.: RUBR-1348C
• Product Overview: Recombinant C. pasteurianum Rubredoxin Protein (1-54aa) was expressed in E. coli with N-terminal His tag.

Specification

• Species: C.pasteurianum
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-54 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 22.0 kDa
• AA Sequence: MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Rubredoxin
• Official Symbol: Rubredoxin
• Synonyms: Rubredoxin; Rd
• UniProt ID: P00268