Recombinant C. trachomatis omcB Protein, His-SUMO-tagged

Cat.No. : omcB-1305C
Product Overview : Recombinant C. trachomatis (strain D/UW-3/Cx) omcB Protein (41-196aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : C.trachomatis
Source : E.coli
Tag : His&SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 33.1 kDa
AA Sequence : LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVP
EYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWV
KPLKEGCCFTAATVCA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name omcB outer membrane protein OmcB [ Chlamydia trachomatis D/UW-3/CX ]
Official Symbol omcB
Synonyms outer membrane protein OmcB; omcB; Large-CRP; 60 kDa cysteine-rich OMP; 60 kDa outer membrane protein; Cysteine-rich outer membrane protein; Large cysteine-rich periplasmic protein OmcB
Gene ID 884223
Protein Refseq NP_219955.1
UniProt ID P0CC04

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All omcB Products

Required fields are marked with *

My Review for All omcB Products

Required fields are marked with *

0
cart-icon