Recombinant C. trachomatis omcB Protein, His-SUMO-tagged

• Cat.No.: omcB-1305C
• Product Overview: Recombinant C. trachomatis (strain D/UW-3/Cx) omcB Protein (41-196aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: C.trachomatis
• Source: E.coli
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 33.1 kDa
• AA Sequence: LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVP
  EYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWV
  KPLKEGCCFTAATVCA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: omcB outer membrane protein OmcB [ Chlamydia trachomatis D/UW-3/CX ]
• Official Symbol: omcB
• Synonyms: outer membrane protein OmcB; omcB; Large-CRP; 60 kDa cysteine-rich OMP; 60 kDa outer membrane protein; Cysteine-rich outer membrane protein; Large cysteine-rich periplasmic protein OmcB
• Gene ID: 884223
• Protein Refseq: NP_219955.1
• UniProt ID: P0CC04