Recombinant Canine IFNG protein

Cat.No. : IFNG-7822C
Product Overview : Recombinant Canine IFNG protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Canine
Source : E.coli
Tag : Non
Protein Length : 143
Description : Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Form : Lyophilized from a 0.2 µm filtered concentrated solution in 25 mM Sodium Succinate, pH 5.0, 60 mM NaCl, with 0.1 % Tween-80.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using A-72 canine fibroma cells infected with vesicular stomatitis virus (VSV) is less than 2.0 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 16.9 kDa, a single non-glycosylated polypeptide chain containing 143 amino acids.
AA Sequence : QAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWREESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK
Endotoxin : Less than 0.1 EU/µg of rCaIFN-γ as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IFNG
Official Symbol IFNG
Synonyms IFN-G; IFN-gamma
Gene ID 403801
mRNA Refseq NM_001003174.1
Protein Refseq NP_001003174.1
UniProt ID P42161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNG Products

Required fields are marked with *

My Review for All IFNG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon