"DUT" Related Products

Expand
Expand

Recombinant Canis lupus DUT protein, His-tagged

Cat.No.: DUT-12C
Product Overview: Recombinant Canis lupus DUT fused with His tag was expressed in E. coli.
Source: E. coli
Species: Canis lupus
Tag : His
Form: 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0
Molecular Mass: ~18.136 kDa
AA Sequence: MGHHHHHHTPAISPSKRARPAEDGMRLRFVRLSEHATAPTKGSPRAAGYDLYSAYDYILPPMEKAIVKTDIQVALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGKN
Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method
Purity: >95% by SDS-PAGE
Gene Name: DUT deoxyuridine triphosphatase [ Canis lupus familiaris ]
Official Symbol: DUT
Synonyms: deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial; dUTP pyrophosphatase
Gene ID: 609526
Chromosome Location: chromosome: 30
Pathway: Metabolic pathways, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.