Recombinant Canis lupus DUT protein, His-tagged

Cat.No. : DUT-12C
Product Overview : Recombinant Canis lupus DUT fused with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Canis lupus
Source : E.coli
Tag : His
Form : 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0
Molecular Mass : ~18.136 kDa
AA Sequence : MGHHHHHHTPAISPSKRARPAEDGMRLRFVRLSEHATAPTKGSPRAAGYDLYSAYDYILPPMEKAIVKTDIQVALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGKN
Endotoxin : < 1.0 EU per μg of the protein as determined by the LAL method
Purity : >95% by SDS-PAGE
Gene Name DUT deoxyuridine triphosphatase [ Canis lupus familiaris ]
Official Symbol DUT
Synonyms deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial; dUTP pyrophosphatase
Gene ID 609526
Chromosome Location chromosome: 30
Pathway Metabolic pathways, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUT Products

Required fields are marked with *

My Review for All DUT Products

Required fields are marked with *

0
cart-icon