Recombinant Canis lupus DUT protein, His-tagged
Cat.No. : | DUT-12C |
Product Overview : | Recombinant Canis lupus DUT fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Canis lupus |
Source : | E.coli |
Tag : | His |
Form : | 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0 |
Molecular Mass : | ~18.136 kDa |
AA Sequence : | MGHHHHHHTPAISPSKRARPAEDGMRLRFVRLSEHATAPTKGSPRAAGYDLYSAYDYILPPMEKAIVKTDIQVALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGKN |
Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method |
Purity : | >95% by SDS-PAGE |
Gene Name | DUT deoxyuridine triphosphatase [ Canis lupus familiaris ] |
Official Symbol | DUT |
Synonyms | deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial; dUTP pyrophosphatase |
Gene ID | 609526 |
Chromosome Location | chromosome: 30 |
Pathway | Metabolic pathways, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem |
◆ Recombinant Proteins | ||
Dut-449M | Recombinant Mouse Dut Protein, MYC/DDK-tagged | +Inquiry |
DUT-76H | Recombinant Human DUT protein, GST-tagged | +Inquiry |
DUT-12C | Recombinant Canis lupus DUT protein, His-tagged | +Inquiry |
DUT-3772H | Recombinant Human DUT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
dUTPase-88 | Active Recombinant Thermostable dUTPase | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUT-6768HCL | Recombinant Human DUT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUT Products
Required fields are marked with *
My Review for All DUT Products
Required fields are marked with *
0
Inquiry Basket