Recombinant Canis lupus DUT protein, His-tagged
| Cat.No. : | DUT-12C | 
| Product Overview : | Recombinant Canis lupus DUT fused with His tag was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Canis lupus | 
| Source : | E.coli | 
| Tag : | His | 
| Form : | 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0 | 
| Molecular Mass : | ~18.136 kDa | 
| AA Sequence : | MGHHHHHHTPAISPSKRARPAEDGMRLRFVRLSEHATAPTKGSPRAAGYDLYSAYDYILPPMEKAIVKTDIQVALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGKN | 
| Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method | 
| Purity : | >95% by SDS-PAGE | 
| Gene Name | DUT deoxyuridine triphosphatase [ Canis lupus familiaris ] | 
| Official Symbol | DUT | 
| Synonyms | deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial; dUTP pyrophosphatase | 
| Gene ID | 609526 | 
| Chromosome Location | chromosome: 30 | 
| Pathway | Metabolic pathways, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem | 
| ◆ Recombinant Proteins | ||
| DUT-6598H | Recombinant Human DUT protein, His-tagged | +Inquiry | 
| DUT-12C | Recombinant Canis lupus DUT protein, His-tagged | +Inquiry | 
| DUT-12221H | Recombinant Human DUT, GST-tagged | +Inquiry | 
| DUT-3527C | Recombinant Chicken DUT | +Inquiry | 
| DUT-791H | Recombinant Human DUT protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DUT-6768HCL | Recombinant Human DUT 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUT Products
Required fields are marked with *
My Review for All DUT Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            