Recombinant Canis lupus DUT protein, His-tagged
| Cat.No. : | DUT-12C |
| Product Overview : | Recombinant Canis lupus DUT fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Canis lupus |
| Source : | E.coli |
| Tag : | His |
| Form : | 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0 |
| Molecular Mass : | ~18.136 kDa |
| AA Sequence : | MGHHHHHHTPAISPSKRARPAEDGMRLRFVRLSEHATAPTKGSPRAAGYDLYSAYDYILPPMEKAIVKTDIQVALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGKN |
| Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method |
| Purity : | >95% by SDS-PAGE |
| Gene Name | DUT deoxyuridine triphosphatase [ Canis lupus familiaris ] |
| Official Symbol | DUT |
| Synonyms | deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial; dUTP pyrophosphatase |
| Gene ID | 609526 |
| Chromosome Location | chromosome: 30 |
| Pathway | Metabolic pathways, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem |
| ◆ Recombinant Proteins | ||
| Dut-449M | Recombinant Mouse Dut Protein, MYC/DDK-tagged | +Inquiry |
| DUT-77H | Recombinant Human DUT protein, His-tagged | +Inquiry |
| DUT-1524Z | Recombinant Zebrafish DUT | +Inquiry |
| DUT-790H | Recombinant Human DUT protein | +Inquiry |
| DUT-1979R | Recombinant Rat Dut protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DUT-6768HCL | Recombinant Human DUT 293 Cell Lysate | +Inquiry |
| DUT-147HKCL | Human DUT Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUT Products
Required fields are marked with *
My Review for All DUT Products
Required fields are marked with *



