Recombinant Human DUT protein

Cat.No. : DUT-790H
Product Overview : Recombinant Human DUT(Met1-Asn164) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : Met1-Asn164
Form : Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
AA Sequence : MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAV VKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIA QLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Shipping : The product is shipped on dry ice/ice packs.
Gene Name DUT deoxyuridine triphosphatase [ Homo sapiens ]
Official Symbol DUT
Synonyms DUT; deoxyuridine triphosphatase; dUTP pyrophosphatase; deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial; dUTPase; dUTP nucleotidohydrolase; FLJ20622;
Gene ID 1854
mRNA Refseq NM_001025248
Protein Refseq NP_001020419
MIM 601266
UniProt ID P33316
Chromosome Location 15q21.1
Pathway Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine biosynthesis, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem;
Function dUTP diphosphatase activity; hydrolase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUT Products

Required fields are marked with *

My Review for All DUT Products

Required fields are marked with *

0
cart-icon