"DUT" Related Products

Expand
Expand

Recombinant Human DUT protein

Cat.No.: DUT-790H
Product Overview: Recombinant Human DUT(Met1-Asn164) was expressed in E. coli.
Source: E. coli
Species: Human
Form: Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Protein length: Met1-Asn164
AA Sequence: MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAV VKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIA QLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Shipping: The product is shipped on dry ice/ice packs.
Gene Name: DUT deoxyuridine triphosphatase [ Homo sapiens ]
Official Symbol: DUT
Synonyms: DUT; deoxyuridine triphosphatase; dUTP pyrophosphatase; deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial; dUTPase; dUTP nucleotidohydrolase; FLJ20622;
Gene ID: 1854
mRNA Refseq: NM_001025248
Protein Refseq: NP_001020419
MIM: 601266
UniProt ID: P33316
Chromosome Location: 15q21.1
Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine biosynthesis, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem;
Function: dUTP diphosphatase activity; hydrolase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.