Recombinant Carica papaya Papain protein, His-tagged
Cat.No. : | Papain-1319C |
Product Overview : | Recombinant Carica papaya Papain protein(P00784)(134-345aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Carica papaya |
Source : | E.coli |
Tag : | His |
Protein Length : | 134-345aa |
Tag : | N-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
Molecular Mass : | 27.4kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. |
AA Sequence : | IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN |
◆ Recombinant Proteins | ||
Papain-4245P | Recombinant Papaya Papain protein, His-tagged | +Inquiry |
Papain-1319C | Recombinant Carica papaya Papain protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Papain-149 | Active Native Immobilized Papain | +Inquiry |
Papain-12 | Native Carica papaya latex Papain | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Papain Products
Required fields are marked with *
My Review for All Papain Products
Required fields are marked with *