Recombinant Cat MSTN protein, His-tagged
Cat.No. : | MSTN-5633C |
Product Overview : | Recombinant Cat MSTN protein(M3WPT7)(19-375aa), fused with N-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cat |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-375aa |
Tag : | N-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
◆ Recombinant Proteins | ||
Mstn-910M | Active Recombinant Mouse Mstn Protein, His-tagged | +Inquiry |
MSTN-2089H | Recombinant Human MSTN Protein, MYC/DDK-tagged | +Inquiry |
Mstn-355M | Recombinant Mouse Myostatin | +Inquiry |
MSTN-3798R | Recombinant Rat MSTN Protein | +Inquiry |
MSTN-4189H | Recombinant Human MSTN Protein (Leu23-Ser375), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSTN-2229MCL | Recombinant Mouse MSTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSTN Products
Required fields are marked with *
My Review for All MSTN Products
Required fields are marked with *
0
Inquiry Basket