Recombinant Cervid PRNP protein, His-tagged

Cat.No. : PRP-02C
Product Overview : Recombinant Cervid PRNP Protein with a His tag was expressed in E. coli.
Availability June 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cervid
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. An overlapping open reading frame has been found for this gene that encodes a smaller, structurally unrelated protein, AltPrp. Alternative splicing results in multiple transcript variants.
Molecular Mass : ~ 17.3 kDa, reducing conditions
AA Sequence : MGGGWGQSGTHSQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVHDCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQLEHHHHHH
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.12 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in PBS, pH 8.0
Gene Name PRNP prion protein [ Cervus canadensis ]
Official Symbol PRNP
Synonyms PRNP; prion protein; PrP; major prion protein; prion protein PrP
Gene ID 122448236
mRNA Refseq XM_043479407
Protein Refseq XP_043335342
UniProt ID P79142

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRNP Products

Required fields are marked with *

My Review for All PRNP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon