Recombinant Cervid PRNP protein, His-tagged
| Cat.No. : | PRP-02C |
| Product Overview : | Recombinant Cervid PRNP Protein with a His tag was expressed in E. coli. |
| Availability | July 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cervid |
| Source : | E.coli |
| Tag : | His |
| Description : | The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. An overlapping open reading frame has been found for this gene that encodes a smaller, structurally unrelated protein, AltPrp. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | ~ 17.3 kDa, reducing conditions |
| AA Sequence : | MGGGWGQSGTHSQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVHDCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQLEHHHHHH |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.12 mg/mL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in PBS, pH 8.0 |
| Gene Name | PRNP prion protein [ Cervus canadensis ] |
| Official Symbol | PRNP |
| Synonyms | PRNP; prion protein; PrP; major prion protein; prion protein PrP |
| Gene ID | 122448236 |
| mRNA Refseq | XM_043479407 |
| Protein Refseq | XP_043335342 |
| UniProt ID | P79142 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRNP Products
Required fields are marked with *
My Review for All PRNP Products
Required fields are marked with *
