Recombinant Chicken ANOS1 Protein (22-281 aa), His-tagged

Cat.No. : ANOS1-2086C
Product Overview : Recombinant Chicken ANOS1 Protein (22-281 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Chicken
Source : E.coli
Tag : His
Protein Length : 22-281 aa
Description : May be an adhesion-like molecule with anti-protease activity.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 33.2 kDa
AA Sequence : SPAGPGAATARRQDEAFSTARCTSRCLSLQITRISAFFKHFQNNGSLAWCQNHKQCSKCLEPCKESWDLKKNHCQSFCEPLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAAACVESCEADSECSGVKKCCSNGCGHTCQVPKNLYKGVPLKPRKELKFIELQSGDLEVKWSSKFNISIEPVIYVVQRRWNQGIHPSEDDATNWQTVAQTTDERVQLSDIRASRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name ANOS1 anosmin 1 [ Gallus gallus (chicken) ]
Official Symbol ANOS1
Synonyms KAL; KAL1; anosmin-1;
Gene ID 396395
mRNA Refseq NM_205424
Protein Refseq NP_990755
UniProt ID P33005

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANOS1 Products

Required fields are marked with *

My Review for All ANOS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon