Recombinant Chicken ANOS1 Protein (22-281 aa), His-tagged
Cat.No. : | ANOS1-2086C |
Product Overview : | Recombinant Chicken ANOS1 Protein (22-281 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-281 aa |
Description : | May be an adhesion-like molecule with anti-protease activity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.2 kDa |
AA Sequence : | SPAGPGAATARRQDEAFSTARCTSRCLSLQITRISAFFKHFQNNGSLAWCQNHKQCSKCLEPCKESWDLKKNHCQSFCEPLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAAACVESCEADSECSGVKKCCSNGCGHTCQVPKNLYKGVPLKPRKELKFIELQSGDLEVKWSSKFNISIEPVIYVVQRRWNQGIHPSEDDATNWQTVAQTTDERVQLSDIRASRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | ANOS1 anosmin 1 [ Gallus gallus (chicken) ] |
Official Symbol | ANOS1 |
Synonyms | KAL; KAL1; anosmin-1; |
Gene ID | 396395 |
mRNA Refseq | NM_205424 |
Protein Refseq | NP_990755 |
UniProt ID | P33005 |
◆ Recombinant Proteins | ||
ANOS1-002H | Recombinant Human ANOS1 Protein, His-tagged | +Inquiry |
ANOS1-2086C | Recombinant Chicken ANOS1 Protein (22-281 aa), His-tagged | +Inquiry |
ANOS1-158H | Recombinant Human ANOS1 Protein, His-tagged | +Inquiry |
ANOS1-206H | Active Recombinant Human ANOS1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANOS1 Products
Required fields are marked with *
My Review for All ANOS1 Products
Required fields are marked with *