Recombinant Chicken ANXA5 Protein tagged
| Cat.No. : | ANXA5-01C |
| Product Overview : | The Chicken Annexin V recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | Yeast |
| Description : | Collagen-binding protein. |
| Molecular Mass : | 36.1 kDa |
| AA Sequence : | MAKYTRGTVTAFSPFDARADAEALRKAMKGMGTDEETILKILTSRNNAQRQEIASAFKTLFGRDLVDDLKSELTGKFETLMVSLMRPARIFDAHALKHAIKGAGTNEKVLTEILASRTPAEVQNIKQVYMQEYEANLEDKITGETSGHFQRLLVVLLQAN |
| Gene Name | ANXA5 annexin A5 [ Gallus gallus (chicken) ] |
| Official Symbol | ANXA5 |
| Synonyms | ANXA5; annexin A5; ANX5; annexin A5; CBP-I; PAP-I; VAC-alpha; anchorin CII; annexin V; annexin-5; calphobindin I; endonexin II; lipocortin V; placental anticoagulant protein I; thromboplastin inhibitor; vascular anticoagulant-alpha |
| Gene ID | 428767 |
| mRNA Refseq | NM_001031538 |
| Protein Refseq | NP_001026709 |
| UniProt ID | P17153 |
| ◆ Recombinant Proteins | ||
| ANXA5-9698H | Active Recombinant Human ANXA5 protein, His-tagged | +Inquiry |
| Anxa5-609M | Recombinant Mouse Anxa5 Protein, MYC/DDK-tagged | +Inquiry |
| ANXA5-169H | Active Recombinant Human ANXA5 protein, His-tagged | +Inquiry |
| Anxa5-3497R | Recombinant Rat Anxa5, His-tagged | +Inquiry |
| ANXA5-19H | Recombinant Human ANXA5 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANXA5-038HKCL | Human ANXA5 Knockdown Cell Lysate | +Inquiry |
| ANXA5-8830HCL | Recombinant Human ANXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA5 Products
Required fields are marked with *
My Review for All ANXA5 Products
Required fields are marked with *



