Recombinant Chicken ANXA5 Protein tagged

Cat.No. : ANXA5-01C
Product Overview : The Chicken Annexin V recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Chicken
Source : Yeast
Description : Collagen-binding protein.
Molecular Mass : 36.1 kDa
AA Sequence : MAKYTRGTVTAFSPFDARADAEALRKAMKGMGTDEETILKILTSRNNAQRQEIASAFKTLFGRDLVDDLKSELTGKFETLMVSLMRPARIFDAHALKHAIKGAGTNEKVLTEILASRTPAEVQNIKQVYMQEYEANLEDKITGETSGHFQRLLVVLLQAN
Gene Name ANXA5 annexin A5 [ Gallus gallus (chicken) ]
Official Symbol ANXA5
Synonyms ANXA5; annexin A5; ANX5; annexin A5; CBP-I; PAP-I; VAC-alpha; anchorin CII; annexin V; annexin-5; calphobindin I; endonexin II; lipocortin V; placental anticoagulant protein I; thromboplastin inhibitor; vascular anticoagulant-alpha
Gene ID 428767
mRNA Refseq NM_001031538
Protein Refseq NP_001026709
UniProt ID P17153

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANXA5 Products

Required fields are marked with *

My Review for All ANXA5 Products

Required fields are marked with *

0
cart-icon