Recombinant Chicken ANXA5 Protein tagged
Cat.No. : | ANXA5-01C |
Product Overview : | The Chicken Annexin V recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | Yeast |
Description : | Collagen-binding protein. |
Molecular Mass : | 36.1 kDa |
AA Sequence : | MAKYTRGTVTAFSPFDARADAEALRKAMKGMGTDEETILKILTSRNNAQRQEIASAFKTLFGRDLVDDLKSELTGKFETLMVSLMRPARIFDAHALKHAIKGAGTNEKVLTEILASRTPAEVQNIKQVYMQEYEANLEDKITGETSGHFQRLLVVLLQAN |
Gene Name | ANXA5 annexin A5 [ Gallus gallus (chicken) ] |
Official Symbol | ANXA5 |
Synonyms | ANXA5; annexin A5; ANX5; annexin A5; CBP-I; PAP-I; VAC-alpha; anchorin CII; annexin V; annexin-5; calphobindin I; endonexin II; lipocortin V; placental anticoagulant protein I; thromboplastin inhibitor; vascular anticoagulant-alpha |
Gene ID | 428767 |
mRNA Refseq | NM_001031538 |
Protein Refseq | NP_001026709 |
UniProt ID | P17153 |
◆ Recombinant Proteins | ||
Anxa5-168R | Recombinant Rat Anxa5 Protein, His-tagged | +Inquiry |
ANXA5-2623H | Recombinant Human Annexin A5, APC | +Inquiry |
ANXA5-19H | Recombinant Human ANXA5 protein, GST-tagged | +Inquiry |
ANXA5-454H | Recombinant Human ANXA5 protein, His-tagged, Animal-Free | +Inquiry |
ANXA5-585M | Recombinant Mouse ANXA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA5-8830HCL | Recombinant Human ANXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA5 Products
Required fields are marked with *
My Review for All ANXA5 Products
Required fields are marked with *
0
Inquiry Basket