Recombinant Chicken FGF7 Protein, His tagged

Cat.No. : FGF7-1900C
Product Overview : Recombinant Chicken FGF7 Protein with His tag was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Chicken
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis.
Molecular Mass : The protein has a calculated MW of 21 kDa.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDVRVRRLFCRTQWYMRIDKRGKVKGTREANNNYSILEIRTVAVGIVAIKGVESEYFLAMNKSGRLYGKKVCNEDCNFIELIEENHYNTYASAKWTHKGKEMFVTLNHKGVPMKGKKTKKEHRASHFLPLAIS
Endotoxin : < 1 EU/μg by LAL
Purity : > 95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 67 μg/mL by BCA
Storage Buffer : Sterile 50 mM Tris, pH 8.0, 100 mM NaCl
Gene Name FGF7 fibroblast growth factor 7 [ Gallus gallus (chicken) ]
Official Symbol FGF7
Synonyms FGF7; fibroblast growth factor 7; KGF; HBGF-7; fibroblast growth factor 7; FGF-7; heparin-binding growth factor 7; keratinocyte growth factor
Gene ID 415439
mRNA Refseq NM_001012525
Protein Refseq NP_001012543
UniProt ID Q5KRA4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FGF7 Products

Required fields are marked with *

My Review for All FGF7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon