Species : |
Chicken |
Source : |
E.coli |
Tag : |
His |
Description : |
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. |
Molecular Mass : |
The protein has a calculated MW of 21 kDa. |
AA Sequence : |
MGSSHHHHHHSSGLVPRGSHMCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDVRVRRLFCRTQWYMRIDKRGKVKGTREANNNYSILEIRTVAVGIVAIKGVESEYFLAMNKSGRLYGKKVCNEDCNFIELIEENHYNTYASAKWTHKGKEMFVTLNHKGVPMKGKKTKKEHRASHFLPLAIS |
Endotoxin : |
< 1 EU/μg by LAL |
Purity : |
> 95% by SDS-PAGE |
Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : |
67 μg/mL by BCA |
Storage Buffer : |
Sterile 50 mM Tris, pH 8.0, 100 mM NaCl |