Recombinant Chicken FGF7 Protein, His tagged
Cat.No. : | FGF7-1900C |
Product Overview : | Recombinant Chicken FGF7 Protein with His tag was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. |
Molecular Mass : | The protein has a calculated MW of 21 kDa. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDVRVRRLFCRTQWYMRIDKRGKVKGTREANNNYSILEIRTVAVGIVAIKGVESEYFLAMNKSGRLYGKKVCNEDCNFIELIEENHYNTYASAKWTHKGKEMFVTLNHKGVPMKGKKTKKEHRASHFLPLAIS |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 67 μg/mL by BCA |
Storage Buffer : | Sterile 50 mM Tris, pH 8.0, 100 mM NaCl |
Gene Name | FGF7 fibroblast growth factor 7 [ Gallus gallus (chicken) ] |
Official Symbol | FGF7 |
Synonyms | FGF7; fibroblast growth factor 7; KGF; HBGF-7; fibroblast growth factor 7; FGF-7; heparin-binding growth factor 7; keratinocyte growth factor |
Gene ID | 415439 |
mRNA Refseq | NM_001012525 |
Protein Refseq | NP_001012543 |
UniProt ID | Q5KRA4 |
◆ Recombinant Proteins | ||
FGF7-5224D | Recombinant Dog FGF7 protein, Avi-tagged, Biotinylated | +Inquiry |
FGF7-345F | Active Recombinant Human FGF7 Protein (164 aa) | +Inquiry |
FGF7-188H | Recombinant Human FGF7 protein | +Inquiry |
FGF7-2913H | Recombinant Human FGF7 protein, His-B2M-tagged | +Inquiry |
FGF7-512H | Active Recombinant Human FGF7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF7 Products
Required fields are marked with *
My Review for All FGF7 Products
Required fields are marked with *