Recombinant Chicken IL8L2 Protein

Cat.No. : IL8L2-1259C
Product Overview : Recombinant Chicken IL8L2 protein (17-102aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Chicken
Source : E.coli
Tag : Non
Protein Length : 17-102 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 9.4 kDa
AA Sequence : ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQL
IVKALMAKAQLNSDAP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name IL8L2 interleukin 8-like 2 [ Gallus gallus (chicken) ]
Official Symbol IL8L2
Synonyms 9E3; C-X-C motif chemokine 8; CEF-4; CEF-4/9E3 cytokine; IL-8; RSV-induced protein; chemokine (C-X-C motif) ligand 8; embryo fibroblast protein 1; putatitve interleukin-8; transformation-induced protein
Gene ID 396495
UniProt ID P08317

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL8L2 Products

Required fields are marked with *

My Review for All IL8L2 Products

Required fields are marked with *

0
cart-icon
0
compare icon