Recombinant Chicken IL8L2 Protein
| Cat.No. : | IL8L2-1259C |
| Product Overview : | Recombinant Chicken IL8L2 protein (17-102aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 17-102 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 9.4 kDa |
| AA Sequence : | ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQL IVKALMAKAQLNSDAP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | IL8L2 interleukin 8-like 2 [ Gallus gallus (chicken) ] |
| Official Symbol | IL8L2 |
| Synonyms | 9E3; C-X-C motif chemokine 8; CEF-4; CEF-4/9E3 cytokine; IL-8; RSV-induced protein; chemokine (C-X-C motif) ligand 8; embryo fibroblast protein 1; putatitve interleukin-8; transformation-induced protein |
| Gene ID | 396495 |
| UniProt ID | P08317 |
| ◆ Recombinant Proteins | ||
| IL8L2-1259C | Recombinant Chicken IL8L2 Protein | +Inquiry |
| IL8L2-32C | Recombinant Chicken IL8L2 Protein | +Inquiry |
| IL8L2-7047C | Recombinant Chicken IL8L2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL8L2 Products
Required fields are marked with *
My Review for All IL8L2 Products
Required fields are marked with *



