Recombinant Chicken RHOT1 Protein (1-219 aa), His-SUMO-tagged
Cat.No. : | RHOT1-2027C |
Product Overview : | Recombinant Chicken RHOT1 Protein (1-219 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-219 aa |
Description : | Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 41.0 kDa |
AA Sequence : | MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQNDEQLYHEISQANVICIVYAVNNKNSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNRSELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFRISDQDNDGTLNDAELNFFQRICFNT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | RHOT1 ras homolog family member T1 [ Gallus gallus (chicken) ] |
Official Symbol | RHOT1 |
Synonyms | RHOT1; MIRO-1 Alternative name(s): Ras homolog gene family member T1; |
Gene ID | 417410 |
mRNA Refseq | NM_001006208 |
Protein Refseq | NP_001006208 |
UniProt ID | Q5ZM73 |
◆ Recombinant Proteins | ||
RHOT1-261H | Active Recombinant Human RHOT1 protein, His-tagged | +Inquiry |
RHOT1-1357C | Recombinant Chicken RHOT1 | +Inquiry |
RHOT1-7592M | Recombinant Mouse RHOT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOT1-2027C | Recombinant Chicken RHOT1 Protein (1-219 aa), His-SUMO-tagged | +Inquiry |
RHOT1-13H | Recombinant Full Length Human RHOT1 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOT1-1506HCL | Recombinant Human RHOT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOT1 Products
Required fields are marked with *
My Review for All RHOT1 Products
Required fields are marked with *