Recombinant Chinese hamster NEU2 protein, His&Myc-tagged
Cat.No. : | NEU2-2317C |
Product Overview : | Recombinant Chinese hamster NEU2 protein(Q64393)(1-379aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chinese hamster |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1-379aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.8 kDa |
AA Sequence : | MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
◆ Recombinant Proteins | ||
NEU2-5786C | Recombinant Chinese hamster NEU2 protein, His-tagged | +Inquiry |
Neu2-4379M | Recombinant Mouse Neu2 Protein, Myc/DDK-tagged | +Inquiry |
NEU2-729H | Recombinant Human NEU2 Protein, His-tagged | +Inquiry |
NEU2-95HFL | Active Recombinant Full Length Human NEU2 Protein, C-Flag-tagged | +Inquiry |
NEU2-4917H | Recombinant Human NEU2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEU2-3870HCL | Recombinant Human NEU2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEU2 Products
Required fields are marked with *
My Review for All NEU2 Products
Required fields are marked with *