Recombinant Chinese hamster NEU2 protein, His&Myc-tagged
| Cat.No. : | NEU2-2317C |
| Product Overview : | Recombinant Chinese hamster NEU2 protein(Q64393)(1-379aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chinese hamster |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 1-379aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 45.8 kDa |
| AA Sequence : | MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| ◆ Recombinant Proteins | ||
| NEU2-4917H | Recombinant Human NEU2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NEU2-1502H | Recombinant Human NEU2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NEU2-5786C | Recombinant Chinese hamster NEU2 protein, His-tagged | +Inquiry |
| NEU2-2317C | Recombinant Chinese hamster NEU2 protein, His&Myc-tagged | +Inquiry |
| Neu2-1189R | Recombinant Rat Neu2 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NEU2-3870HCL | Recombinant Human NEU2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEU2 Products
Required fields are marked with *
My Review for All NEU2 Products
Required fields are marked with *
