Recombinant Clostridium Acetobutylicum CTFB Protein (1-221 aa), His-Myc-tagged

Cat.No. : CTFB-2649C
Product Overview : Recombinant Clostridium Acetobutylicum (strain ATCC 824/DSM 792/JCM 1419/LMG 5710/VKM B-1787) CTFB Protein (1-221 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Clostridium Acetobutylicum
Source : E.coli
Tag : His&Myc
Protein Length : 1-221 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 30.6 kDa
AA Sequence : MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAKKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGLLLTEINKNTTIDEIRSLTAADLLISNELRPMAV
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name ctfb butyrate-acetoacetate COA-transferase subunit B [ Clostridium acetobutylicum ATCC 824 ]
Official Symbol CTFB
Synonyms ctfB;
Gene ID 1116169
Protein Refseq NP_149327
UniProt ID P23673

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTFB Products

Required fields are marked with *

My Review for All CTFB Products

Required fields are marked with *

0
cart-icon
0
compare icon