Recombinant Clostridium Acetobutylicum CTFB Protein (1-221 aa), His-Myc-tagged
Cat.No. : | CTFB-2649C |
Product Overview : | Recombinant Clostridium Acetobutylicum (strain ATCC 824/DSM 792/JCM 1419/LMG 5710/VKM B-1787) CTFB Protein (1-221 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium Acetobutylicum |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-221 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 30.6 kDa |
AA Sequence : | MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAKKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGLLLTEINKNTTIDEIRSLTAADLLISNELRPMAV |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | ctfb butyrate-acetoacetate COA-transferase subunit B [ Clostridium acetobutylicum ATCC 824 ] |
Official Symbol | CTFB |
Synonyms | ctfB; |
Gene ID | 1116169 |
Protein Refseq | NP_149327 |
UniProt ID | P23673 |
◆ Recombinant Proteins | ||
CTFB-2649C | Recombinant Clostridium Acetobutylicum CTFB Protein (1-221 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTFB Products
Required fields are marked with *
My Review for All CTFB Products
Required fields are marked with *
0
Inquiry Basket