Recombinant Clostridium Botulinum PBPA Protein (663-830 aa), His-SUMO-tagged

Cat.No. : PBPA-2169C
Product Overview : Recombinant Clostridium Botulinum (strain Hall/ATCC 3502/NCTC 13319/Type A) PBPA Protein (663-830 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Clostridium Botulinum
Source : E.coli
Tag : His&SUMO
Protein Length : 663-830 aa
Description : Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 35.2 kDa
AA Sequence : VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRRDYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNNNNNNDNNNNTKPPENDSNQNHEDNKNKQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Synonyms pbpA; Peptidoglycan TGase DD-transpeptidase;
UniProt ID A5I6G4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PBPA Products

Required fields are marked with *

My Review for All PBPA Products

Required fields are marked with *

0
cart-icon
0
compare icon