Recombinant Colwellia Psychrerythraea DINB Protein (1-352 aa)
Cat.No. : | DINB-2263C |
Product Overview : | Recombinant Colwellia Psychrerythraea (strain 34H/ATCC BAA-681) (Vibrio psychroerythus) DINB Protein (1-352 aa) is produced by E. coli expression system. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Colwellia Psychrerythraea |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-352 aa |
Description : | Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDISTQDECKLVIDSLYQKLLTRLAPHSNREIIRQGVKLKFTDFNQTTVETQSNECQQALFISLLSKAYSRSNKRGVRLVGLTLGFADSPGESQQLSLSL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | dinB; |
UniProt ID | Q487H6 |
◆ Recombinant Proteins | ||
DINB-1605B | Recombinant Bacillus subtilis DINB protein, His-tagged | +Inquiry |
dinB-4488V | Recombinant Vibrio psychroerythus dinB protein, His-tagged | +Inquiry |
DINB-2263C | Recombinant Colwellia Psychrerythraea DINB Protein (1-352 aa) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DINB Products
Required fields are marked with *
My Review for All DINB Products
Required fields are marked with *
0
Inquiry Basket