Recombinant Coxiella Burnetii RNFH Protein (1-101 aa), His-SUMO-tagged
Cat.No. : | RNFH-1972C |
Product Overview : | Recombinant Coxiella Burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212)) RNFH Protein (1-101 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Coxiella Burnetii |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-101 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.3 kDa |
AA Sequence : | MISIIIAYATPEKQVEIPLTVEESCTLVVAVKRSGILQQFPEINLSQAIVGIHNKRTALDAGLRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRMVRGEAG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | rnfH; |
UniProt ID | B6IZH9 |
◆ Recombinant Proteins | ||
RNFH-1972C | Recombinant Coxiella Burnetii RNFH Protein (1-101 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNFH Products
Required fields are marked with *
My Review for All RNFH Products
Required fields are marked with *
0
Inquiry Basket