Recombinant Cricetulus Griseus PRDX1 Protein (2-199 aa), His-tagged

• Cat.No.: PRDX1-2679C
• Product Overview: Recombinant Cricetulus Griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1 Protein (2-199 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.

Specification

• Species: Cricetulus Griseus
• Source: Yeast
• Tag: His
• Protein Length: 2-199 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.2 kDa
• AA Sequence: SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Prdx1 peroxiredoxin 1 [ Cricetulus griseus (Chinese hamster) ]
• Official Symbol: PRDX1
• Synonyms: PRDX1; TDPX2; TPX-2
• Gene ID: 100689332
• mRNA Refseq: NM_001246765
• Protein Refseq: NP_001233694
• UniProt ID: Q9JKY1