Recombinant Cricetulus Griseus PRDX1 Protein (2-199 aa), His-tagged

Cat.No. : PRDX1-2679C
Product Overview : Recombinant Cricetulus Griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1 Protein (2-199 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cricetulus Griseus
Source : Yeast
Tag : His
Protein Length : 2-199 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.2 kDa
AA Sequence : SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Prdx1 peroxiredoxin 1 [ Cricetulus griseus (Chinese hamster) ]
Official Symbol PRDX1
Synonyms PRDX1; TDPX2; TPX-2;
Gene ID 100689332
mRNA Refseq NM_001246765
Protein Refseq NP_001233694
UniProt ID Q9JKY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRDX1 Products

Required fields are marked with *

My Review for All PRDX1 Products

Required fields are marked with *

0
cart-icon