Recombinant Cricetulus Griseus PRDX1 Protein (2-199 aa), His-tagged
Cat.No. : | PRDX1-2679C |
Product Overview : | Recombinant Cricetulus Griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1 Protein (2-199 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cricetulus Griseus |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-199 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.2 kDa |
AA Sequence : | SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Prdx1 peroxiredoxin 1 [ Cricetulus griseus (Chinese hamster) ] |
Official Symbol | PRDX1 |
Synonyms | PRDX1; TDPX2; TPX-2; |
Gene ID | 100689332 |
mRNA Refseq | NM_001246765 |
Protein Refseq | NP_001233694 |
UniProt ID | Q9JKY1 |
◆ Recombinant Proteins | ||
PRDX1-3543H | Recombinant Human PRDX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRDX1-2153Z | Recombinant Zebrafish PRDX1 | +Inquiry |
Prdx1-60M | Active Recombinant Full Length Mouse Prdx1 Protein, His-tagged | +Inquiry |
PRDX1-1558HFL | Recombinant Full Length Human PRDX1 Protein, C-Flag-tagged | +Inquiry |
PRDX1-2430H | Recombinant Human PRDX1 Protein (1-199 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX1-2882HCL | Recombinant Human PRDX1 293 Cell Lysate | +Inquiry |
PRDX1-2883HCL | Recombinant Human PRDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX1 Products
Required fields are marked with *
My Review for All PRDX1 Products
Required fields are marked with *